Name: purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli
Uploaded: 2015-12-19T14:00:00.000+00:00
Duration: 9 min 43 s
Description: Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

The authors would like to acknowledge Natalie Doude and David Westerway (University of Alberta) for providing us Sho cDNA, Christophe Chevalier (INRA) for plasmid construction, Michel Br&#233;mont (INRA) for providing us BL21Sol bacteria; Christine Longin (INRA) for TEM assistance and Edith Pajot-Augy (INRA) for comments and proofreading.

플라스미드 및 Shadoo 식의 1 세대 주 : 유전자 부호화 뮤린 Shadoo 단백질 (Shadoo 25부터 1백22까지)를 발현 벡터를 pET-28 (11)에 서브 클로닝 하였다. 이 클론은 E.으로 변화되었다 앞서 설명한 바와 같이 11 대장균 N 말단 헥사 히스티딘 태그 (HHHHHHHHHHSSGHIDDDDKHMKGGRGGARGSARGVRGGARGASRVRVRP APRYGSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSG)와 Shadoo 단백질을 발현하는 균주를 SoluBL21. 플라스미드는 저자에서 요청하실 수 있습니다. 그 아미노산 서열로부터 계산 Shadoo의 분자량은 12,243.2 다이다. 참고 : laminal 흐름 후드 아래에 또는 가까운 분젠 화염에 세균 모든 조작을 수행합니다. <ol><li> 표준 열 쇼크 프로토콜을 사용하여 pET-28-그의 6 -Shadoo 플라스미드 유능한 SoluBL21 박테리아 변환. 플라스미드 1~5 μL이 믹스 (전형적으로 10 내지 100 PG튜브에서 박테리아의 50 μL로 NG). 45 초 동안 42 ℃에서 열 쇼크를 수행한다. </li><li> 배양은 40 ㎎ / ㎖ 카나마이신 (도 1b)로 보충 된 루리아 - 베르 타니 배지에서 0.5 내지 0.7의 600까지 37 ℃에서 형질 전환 된 박테리아. </li><li> 배양에 240 μg의 / ㎖ 이소 프로필 β-D- 티오 갈 락토 피 라노 시드, ITPG를 첨가하여 Shadoo 발현 O / N을 유도한다. 37 ° C에서 150 rpm으로 진탕 배양 균. 참고 : 일반적으로 박테리아 문화가 600 3 O / N의 도달한다. 주 : 형질 전환 박테리아 단백질 생산 미래 -80 ℃에서 저장 될 수있다. 이를 위해, 세균 배양 씩에 10 % -50 % (v / v)의 멸균 글리세롤을 추가하고 -80 ° C에서 그들을 동결. </li></ol><img alt="그림 1" src="/files/ftp_upload/53432/53432fig1.jpg" /> Shadoo 표현의 Shadoo 식 구조, 박테리아의 변화와 유도의 그림 1. 제도 (로 1 단계에서 설명). </stroNG&gt; (A) Shadoo 대한 발현 구성체는 단백질, NT를 N 말단에 융합 헥사 히스티딘 태그를 암호화한다. 방식 Shadoo 단백질이 C 말단 (CT) 다음에 기본 아르기닌 / 글리신 반복 (녹색 실린더), 소수성 도메인 (HD) 및 단일 N 글리코 실화 부위 (CHO)를 포함하고 있음을 보여준다. (B) 애완 동물 (28) - 그의 6 -Shadoo 플라스미드는 42 ℃에서 45 초간 열 충격에 의해 SoluBL21 박테리아로 변환됩니다. 형질 전환 된 박테리아는 선택적 한천 / ㎖ 카나마이신 40 μg의를 포함에 도금되어있다. 플레이트에서 단일 콜로니는 1,000-3,000 ml의 통 플라스크에 문화를 접종하는 데 사용됩니다. 재조합 단백질의 발현이 1 mM의 IPTG로 유도된다. <a href="https://www-jove-com.bdigitaluss.remotexs.co/files/ftp_upload/53432/53432fig1highres.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a> 저압 액체 크로마토 Shadoo 단백질 2. 그래피 (LPLC) <ol><li> 세포 용해 및 Inclusion 기관 준비 <ol><li> 세균 현탁액을 수집하고 원심 분리 튜브 (그림 2)로 전송합니다. </li><li> 4 ℃에서 20 분 동안 2,500 XG에 스핀. 경사 및 세포 배양의 500 ml의에서 파생 된 각각의 펠릿에 대한 재현 탁 펠렛 (항 단백 분해 효소 칵테일 50 mM 트리스, 10 mM의 EDTA, pH를 8) 15 ml의 버퍼에 의해 상층 액을 제거합니다. 주 : 펠릿을 재현 탁시키고 동결 며칠 동안 -20 ℃에서 저장 될 수있다. 냉동은 박테리아 세포 용해를 용이하게한다. </li><li> SDS-PAGE 분석 및 쿠마 염색으로 원유 세균 펠릿을 사용하여 재조합 단백질의 과발현을 확인합니다. <ol><li> 이를 위해, 세균 배양의 원심 분리기 1 ml의 세포 펠렛합니다. 5 분 동안 100 ° C에서 100 μL 램 믈리 변성 펠렛 솔루션 (277.8 mM 트리스 - 염산, pH가 6.8, 4.4 % SDS, W 44.4 % / V 글리세롤, 블루 0.02 % 브로 모 페놀)와 열을 추가합니다. </li><li> 12 % 아크릴 아마이드 겔에 부하 시료 10 μL를 실행 SDS-PAGE 및 VISUALIZE은 쿠마시 염색으로 단백질을 분리 하였다. </li></ol></li><li> ) 2.1.2에서 완전히 재 부유 펠릿에 0.5 % 최종 농도 트리톤 X-100을 추가합니다. </li><li> 30 분 동안 37 ℃ 수욕 중에서 현탁 배양한다. </li><li> 세균 세포를 용해시키기 위해 빙 냉수에 6-12 미크론에서 피크 - 투 - 피크 진폭을 5 분 동안 초음파 처리 현탁액. </li><li> 전송 깨끗한 50 ㎖ 원심 분리 튜브에 서스펜션을 초음파. </li><li> 4 ℃에서 15 분 동안 15,000 XG에 원심 분리기 튜브. </li><li> 경사 분리하여 상층 액을 제거하고 튜브 당 결합 완충액 (20 mM Tris-HCl 완충액, pH 7.4의 0.5 M의 NaCl, 8 M 우레아, 5 mM의 이미 다졸) 5 mL를 추가한다. </li><li> 회전 바퀴 O / N에 장소 튜브가 완전히 봉입체에서 단백질을 재현 탁합니다. </li></ol><img alt="그림 2" src="/files/ftp_upload/53432/53432fig2.jpg" /> 포함의 정제의 그림 2. 계획Shadoo 발현 체 (단계 2.1에 기재된 바와 같이). 형질 전환 된 박테리아를 원심 분리에 의해 수확하고 용해 완충액에 재현 탁된다. 현탁액을 30 분 동안 37 ° C에서 배양 한 후, 세균 세포를 기계적으로 파괴하는 초음파 처리된다. 초음파 처리는 시료의 가열을 방지하는 얼음에 행해진 다. 깨진 세포를 원심 분리에 의해 수확 봉입체에서 단백질을 가용화 8 M 요소를 포함하는 버퍼에 재현 탁하고 있습니다. <a href="https://www-jove-com.bdigitaluss.remotexs.co/files/ftp_upload/53432/53432fig2highres.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a> </li><li> 니켈 2+ - 친 화성 크로마토 그래피 주 : 크로마토 그래피 5 ㎖ 킬레이트 세 파로스 칼럼 (도 3a), 니켈 2+ -charged 이용한 FPLC 시스템에서 수행된다. 모든 용액 / 분으로 1 ml의 유속으로 컬럼에 로딩된다. <ol><li> 충전하기 위해 세 파로스 칼럼에 0.2 M 니소 4 수용액 10 ㎖를 주입니켈 2 + -ions와. </li><li> 이미 다졸의 낮은 농도 (20 mM Tris-HCl 완충액, pH 7.4의 0.5 M의 NaCl, 8 M 우레아, 5 mM의 이미 다졸)을 함유하는 결합 완충액 중 30 ~ 50 ml를 주입함으로써 니켈 2+ -ions 충전 칼럼을 평형화. </li><li> 50 ml를 주입 루프 요소 - 용해 단백질을로드합니다. </li><li> 완전히 결합되지 않은 단백질의 최대 값을 제거하기 위하여 10 ml의 낮은 다졸 결합 완충액 (20 mM Tris-HCl 완충액, pH 7.4의 0.5 M의 NaCl, 8 M 우레아, 5 mM의 이미 다졸)으로 컬럼을 세척하여 관류 분획을 회수 열에서. </li><li> (mM 트리스 -HCl, pH 7.4, 0.5 M의 NaCl, 8 M 우레아, 80 mM의 이미 다졸 20) 비특이적으로 컬럼에 결합 된 단백질을 용출 세척 완충액 중 50 ~ 100 ㎖로 칼럼을 세척 하였다. </li><li> 20 mM 트리스 - 염산, pH 7.4의 0.5 M의 NaCl, 8 M 우레아를 함유하는 완충액에 80에서 8백까지 mM의 이미 다졸을 15 분 선형 구배를 적용. 그라데이션 적용하는 동안 1 ml의 분수를 수집합니다. 참고 : 그의 - 태그 - 단백질은 재치 용출(경쟁자로 사용) 이미 다졸 함유 버퍼의 하 구배. </li><li> (2.1.3.1 참조) 각 부분의 8 μL 나누어지는을 가지고 4 μL 배 램 믈리 변성 솔루션을 추가 할 수 있습니다. 5 분 동안 100 ℃에서 열 솔루션. </li><li> 부하 쿠마시 염색으로 단백질 크기 마커 10 μL 및 12 % 아크릴 아미드 겔에 각 시료 10㎕를 실행 SDS-PAGE 분리 및 가시화 단백질. 주 : 계산 Shadoo의 분자량은 그것의 아미노산 서열이다 형성 12,243.2 다. </li><li> 풀 Shadoo를 포함하는 모든 분획. </li></ol><img alt="그림 3" src="/files/ftp_upload/53432/53432fig3.jpg" /> (단계 2.2에서 2.4 사이의 설명 참조) 3. 정제 절차도. (A)의 Ni 2+ -ions은 폴리 히스티딘 - 태그 된 단백질의 정제를 허용 선택적 히스티딘 잔기에 의해 조정될 수있다. 이미 다졸을 통해 단백질을 용출하는데 사용된다니켈 - 이온 2+로 조정하고 결합 된 단백질을 대체 할 수있는 능력. (B) 크기 배제 칼럼 상으로 분리되어 A 행의 Ni 2+에 보유 된 다양한 유체 역학적 반경의 단백질. 단백질이 작은 사람에게 가장 큰에서 용출된다. (C)를 ​​사용하기 전에, Shadoo을 포함하는 분획을 모으고 요소, 이미 다졸 및 염을 제거하는 탈염된다. 품질 관리 분석은 SDS-PAGE / 쿠마 염색, 웨스턴 블로 팅을 포함한다. 정제 Shadoo은 동결 건조 할 수있다. -20 ° C에서 저장 될 때 동결 건조 Shadoo 달 동안 안정하다. <a href="https://www-jove-com.bdigitaluss.remotexs.co/files/ftp_upload/53432/53432fig3highres.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a> </li><li> 크기 배제 크로마토 그래피 주 : 초 정제 단계가 다른 단백질 제 정제 공정 중에 공동으로부터 용출 Shadoo 단백질을 분리하는 크기 배제 크로마토 그래피로 이루어져(그림 3B). <ol><li> 1.5 ㎖ / 분의 유속으로 20 mM Tris-HCl 완충액, pH 7.4의 0.5 M의 NaCl, 8 M 우레아 250㎖를 주입함으로써 전체 베드 부피 120 ㎖가 슈퍼 덱스 컬럼을 평형화. </li><li> 평형 열 2.2.9에서 Shadoo를 포함하는 부하 풀링 분수. 위의 버퍼의 일정한 흐름에 따라 40 ml를 열 공극 부피 후 1 ml의 분수를 수집합니다. </li><li> 각 부분의 10 μL 나누어지는을 가지고 분수가 Shadoo를 포함하는 알 상술 한 바와 같이 SDS-PAGE 분석 및 쿠마 염색을 수행합니다. </li><li> Shadoo를 포함하는 풀 분수. </li></ol></li><li> 탈염 주 : 탈염 과정은 또한 생물 물리학 적 및 생화학 적 연구 (도 3c)에 적합한 완충액 Shadoo 재조합 단백질을 얻기 위해 염, 이미 다졸 및 우레아를 제거한다. 동일한 결과를 버퍼에 대하여 투석 샘플을 얻을 수있다. <ol><li> 150 ml의 53 ML의 탈염 열 평형/ 분 5 ㎖의 유속으로 10mM의 아세트산 암모늄 완충액, pH가 5의. </li><li> 로드 열 Shadoo 분획을 풀링. 아세트산 암모늄 완충액의 주입시 수동 UV 검출기의 출력에서​​의 280 nm에서 신호의 증가를 보여 분획을 수집한다. </li><li> 동결 건조 탈염 Shadoo을 -20 ℃에서 보관하십시오. </li><li> 적절한 버퍼 내의 동결 건조 Shadoo 같은 된 10 mM 아세트산 나트륨 완충액, pH가 5를 용해, 종래 사용하기. 주 : 폴리 히스티딘 태그는 엔테로 키나제로 제거 할 수있다. </li></ol></li></ol> 생리 학적 pH에서 아밀로이드 피 브릴에 Shadoo의 체외 조립 (3) 주 : 자발적으로 Shadoo 단백질 집계 및 pH를 ≥ 7 (11)에서 섬유를 형성한다. <img alt="그림 4" src="/files/ftp_upload/53432/53432fig4.jpg" /> Shadoo이 아밀로이드 원 섬유에 접힘 그림 4. 제도 (descri로떨고있는 동안 산성 용액에서의 pH ≥ (7)의 버퍼에 용해 할 때 3 단계에서 침대). 정제 Shadoo 자발적 아밀로이드 원 섬유로 변환, Shadoo 1 M GDN-HCl로 배양에 아밀로이드 원 섬유로 변환합니다. 품질 관리 분석 전자 현미경과 THT ​​염색을 포함한다. <a href="https://www-jove-com.bdigitaluss.remotexs.co/files/ftp_upload/53432/53432fig4highres.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a> <ol><li> 20 mM Tris-HCl 완충액, pH 7.4의 2 μM의 최종 농도로 희석 Shadoo. 280 nm에서의 용액의 흡광도를 측정하고 20,970의 Shadoo 아미노산 조성물로부터 추론 흡광 계수를 이용하여 농도를 측정한다. </li><li> 아밀로이드 구조 (그림 4)에 자연 단백질 변환을 할 수 있도록, 몇 주 4 ℃에서 원뿔형 플라스틱 튜브에 용액 500 μl를 품어. </li><li> 갓 최종 conce에 T (THT) thioflavin 준비 추가Shadoo 용액 100 μL 분취 10 μM의 ntration. RT에서 5 분 동안 용액을 배양한다. 아밀로이드 구조 (17)의 존재를 확인하는 435 나노 미터의 여기 파장을 사용하여 460에서 520 nm의 형광 발광을 측정한다. </li></ol> 산성 pH 값에서 아밀로이드 피 브릴에 Shadoo의 체외 조립 4. <ol><li> 2 μM의 최종 농도 1 M GdnHCl, 20 mM의 나트륨 아세테이트 완충액, pH를 5로 희석 Shadoo. </li><li> 를 3-7 일 동안, 37 ℃에서 연속 진탕 원추형 튜브 용액 500 μl를 배양한다. </li><li> 3.3에서와 같이 용액의 분취 량을 첨가하여 THT 아밀로이드 피 브릴의 존재를 확인한다. </li><li> Shadoo 아밀로이드 피 브릴를 정화, 10 mM의 나트륨 아세테이트 완충액, pH 5.0으로 대해 얻어진 현탁액을 투석. </li><li> 4 ℃에서 정제 섬유를 저장합니다. </li></ol><img alt="그림 5" src="/files/ftp_upload/53432/53432fig5.jpg"/&gt; 니켈 2+으로부터 용출도 5 대표 결과. 단백질 분획 킬레이트 컬럼 (A)와 크기 배제 컬럼 (B) SDS-PAGE 및 쿠마시 염색을 이용하여 분석을 하였다 -charged. 정제 Shadoo의 식별이 SPRN 방지 Shadoo 항체 (C)를 ​​사용하여 평가 하였다. <a href="https://www-jove-com.bdigitaluss.remotexs.co/files/ftp_upload/53432/53432fig5large.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a>

<ol>
	<li>Biasini, E., Turnbaugh, J. A., Unterberger, U., Harris, D. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+protein+at+the+crossroads+of+physiology+and+disease.">Prion protein at the crossroads of physiology and disease.</a> Trends in Neurosciences. 35, 92-103 (2012).</li><li>Colby, D. W., Prusiner, S. B. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=De+novo+generation+of+prion+strains.">De novo generation of prion strains.</a> Nature Reviews. Microbiology. 9, 771-777 (2011).</li><li>Chiti, F., Dobson, C. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+misfolding,+functional+amyloid,+and+human+disease.">Protein misfolding, functional amyloid, and human disease.</a> Annual Review of Biochemistry. 75, 333-366 (2006).</li><li>Nelson, R., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Structure+of+the+cross-beta+spine+of+amyloid-like+fibrils.">Structure of the cross-beta spine of amyloid-like fibrils.</a> Nature. 435, 773-778 (2005).</li><li>Murphy, R. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Kinetics+of+amyloid+formation+and+membrane+interaction+with+amyloidogenic+proteins.">Kinetics of amyloid formation and membrane interaction with amyloidogenic proteins.</a> Biochimica et Biophysica Acta. 1768, 1923-1934 (2007).</li><li>Steunou, S., Chich, J. F., Rezaei, H., Vidic, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Biosensing+of+lipid-prion+interactions:+insights+on+charge+effect,+Cu(II)-ions+binding+and+prion+oligomerization.">Biosensing of lipid-prion interactions: insights on charge effect, Cu(II)-ions binding and prion oligomerization.</a> Biosensors &amp; Bioelectronics. 26, 1399-1406 (2010).</li><li>Watts, J. C., Westaway, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+prion+protein+family:+diversity,+rivalry,+and+dysfunction.">The prion protein family: diversity, rivalry, and dysfunction.</a> Biochimica et Biophysica Acta. 1772, 654-672 (2007).</li><li>Westaway, D., Daude, N., Wohlgemuth, S., Harrison, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+PrP-like+proteins+Shadoo+and+Doppel.">The PrP-like proteins Shadoo and Doppel.</a> Topics in Current Chemistry. 305, 225-256 (2011).</li><li>Baillod, P., Garrec, J., Tavernelli, I., Rothlisberger, U. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Prion+versus+doppel+protein+misfolding:+new+insights+from+replica-exchange+molecular+dynamics+simulations.">Prion versus doppel protein misfolding: new insights from replica-exchange molecular dynamics simulations.</a> Biochemistry. 52, 8518-8526 (2013).</li><li>Daude, N., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Wild-type+Shadoo+proteins+convert+to+amyloid-like+forms+under+native+conditions.">Wild-type Shadoo proteins convert to amyloid-like forms under native conditions.</a> Journal of Neurochemistry. 113, 92-104 (2010).</li><li>Li, Q., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Shadoo+binds+lipid+membranes+and+undergoes+aggregation+and+fibrillization.">Shadoo binds lipid membranes and undergoes aggregation and fibrillization.</a> Biochemical and Biophysical Research Communications. 438, 519-525 (2013).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+CNS+glycoprotein+Shadoo+has+PrP(C)-like+protective+properties+and+displays+reduced+levels+in+prion+infections.">The CNS glycoprotein Shadoo has PrP(C)-like protective properties and displays reduced levels in prion infections.</a> The EMBO Journal. 26, 4038-4050 (2007).</li><li>Watts, J. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protease-resistant+prions+selectively+decrease+Shadoo+protein.">Protease-resistant prions selectively decrease Shadoo protein.</a> PLoS Pathogens. 7, e1002382 (2011).</li><li>Westaway, D., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Down-regulation+of+Shadoo+in+prion+infections+traces+a+pre-clinical+event+inversely+related+to+PrP(Sc)+accumulation.">Down-regulation of Shadoo in prion infections traces a pre-clinical event inversely related to PrP(Sc) accumulation.</a> PLoS Pathogens. 7, e1002391 (2011).</li><li>Chevalier, C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=PB1-F2+influenza+A+virus+protein+adopts+a+beta-sheet+conformation+and+forms+amyloid+fibers+in+membrane+environments.">PB1-F2 influenza A virus protein adopts a beta-sheet conformation and forms amyloid fibers in membrane environments.</a> The Journal of Biological Chemistry. 285, 13233-13243 (2010).</li><li>Tarus, B., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Oligomerization+paths+of+the+nucleoprotein+of+influenza+A+virus.">Oligomerization paths of the nucleoprotein of influenza A virus.</a> Biochimie. 94, 776-785 (2012).</li><li>Biancalana, M., Koide, S. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Molecular+mechanism+of+Thioflavin-T+binding+to+amyloid+fibrils.">Molecular mechanism of Thioflavin-T binding to amyloid fibrils.</a> Biochimica et Biophysica Acta. 1804, 1405-1412 (2010).</li><li>Minic, J., Sautel, M., Salesse, R., Pajot-Augy, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Yeast+system+as+a+screening+tool+for+pharmacological+assessment+of+g+protein+coupled+receptors.">Yeast system as a screening tool for pharmacological assessment of g protein coupled receptors.</a> Current Medicinal Chemistry. 12, 961-969 (2005).</li><li>Schein, C. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+cool+way+to+make+proteins.">A cool way to make proteins.</a> Nature Biotechnology. 22, 826-827 (2004).</li><li>Sorensen, H. P., Mortensen, K. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Advanced+genetic+strategies+for+recombinant+protein+expression+in+Escherichia+coli.">Advanced genetic strategies for recombinant protein expression in Escherichia coli.</a> Journal of Biotechnology. 115, 113-128 (2005).</li><li>Zhang, J., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Disruption+of+glycosylation+enhances+ubiquitin-mediated+proteasomal+degradation+of+Shadoo+in+Scrapie-infected+rodents+and+cultured+cells.">Disruption of glycosylation enhances ubiquitin-mediated proteasomal degradation of Shadoo in Scrapie-infected rodents and cultured cells.</a> Molecular Neurobiology. 49, 1373-1384 (2014).</li><li>Englund, P. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+structure+and+biosynthesis+of+glycosyl+phosphatidylinositol+protein+anchors.">The structure and biosynthesis of glycosyl phosphatidylinositol protein anchors.</a> Annual Review of Biochemistry. 62, 121-138 (1993).</li><li>Puig, B., Altmeppen, H., Glatzel, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+GPI-anchoring+of+PrP:+implications+in+sorting+and+pathogenesis.">The GPI-anchoring of PrP: implications in sorting and pathogenesis.</a> Prion. 8, 11-18 (2014).</li></ol>

The authors have nothing to disclose.

발현 및 재조합 마우스 Shadoo 단백질의 다량의 정제 모두에 대한 쉽고 효율적인 프로토콜이 제시된다. 기재된 방법은 성공적인 가용화 및 (그의 6) -tagged Shadoo 재조합 단백질을 정제 할 수있다. 제목에서 지적했듯이 그것은 중요하다 원핵 박테리아 E. 표현하는 경우 대장균 Shadoo은 봉입체에 축적. Shadoo 정제에 앞서, 박테리아는 트리톤 X-100을 함유하는 완충액에 용해하여 초음파 처리되어야한다. 이어서 봉입체는 8 M 우레아 변성 용액에 용해 될 수있다. 또한, 전체 정제 과정 Shadoo가 중합 및 응집 경향 때문에 8 M 우레아 완충액에서 수행되어야한다. 친 화성 크로마토 그래피 및 크기 배제 크로마토 그래피 : 가용화 및 봉입체 정화 후 변성 단백질을 함유하는 상등액을 두 단계의 정제 과정에 적용된다. 선호도 chromatog그래피 단계는 니켈 2 +는 킬레이트 열을 -charged에 (그의 6) -tag 통해 Shadoo 결합으로 구성되어 있습니다. 8 M 우레아 수용액 단백질 변성하고 그들의 히스티딘 잔기가 표면에 노출된다. 또한, 우레아 프로테아제 오염의 발생을 방지하여 단백질 분해 Shadoo 구조적 완전성을 촉진한다. 두 번째 정제 단계에서, Shadoo는 이미 다졸 구배 오염 단백질을 분리하기 위해 크기 - 배제 크로마토 그래피로 용리. 두 번째 단계에서, 큰 단백질들은 따라서, 매트릭스의 기공을 입력 할 수없는 등, 첫번째 컬럼을 통해 용출 직접 경로를 갖는다. 그들은 모공을 입력하고 더 복잡한 경로를 가질 수 있기 때문에 작은 단백질, Shadoo로, 열에서 용출하는 데 시간이 더 걸릴. 마지막으로, 단백질 제제는 우레아, 이미 다졸 및 이들의 염을 제거하는 탈염된다. 품질 관리는이 절차 재조합 Shadoo에 따라하는 것은 고순도로 정제되어 있음을 나타냅니다. 이것은 V에서 이용 될 수있다arious 생물학 및 생명 공학 연구. E. 대장균 발현 시스템은 재조합 단백질의 발현에 매우 유용한 도구이다. E.에서 포유류 단백질을 발현의 저렴한 비용, 쉬운 조작, 신속성 및 편리 성 대장균이 호스트 생명 과학 응용 프로그램에 대한 첫 번째 선택 도구의합니다. 그러나, 모든 포유 동물 단백질은 수용성 형태 및 / 또는이 박테리아에 충분한 양으로 표현 될 수 없다. 때때로, 장애물은 대안 매체 18-20를 사용하여, 프로모터를 변경 발현 온도를 저하 정제 태그를 추가하는 등의 다른 전략에 의해 극복 될 수있다. 그러나 어떤 경우에는, 최적의 발현 조건을 찾는 것은 시간과 노력에 많은 비용을 가질 수도있다. 재조합 Shadoo를 생산하는 어려움 SoluBL21 관할 E. 극복했다 대장균 균주. 이 돌연변이 체 숙주 균주 크게 Shadoo 생산 수율을 개선하고 우리가 완전히 용해 얻었다 허용Shadoo. 얻은 수익률의 범위는 5 ~ 10 ㎎ / ℓ 문화에 있었다. 재조합 Shadoo 원형 이색 성 분광법 (11, 12)에 의해 임의의 코일 기능을 제공하는 기본적으로 구조화되지 않은 단백질 것으로 나타났다. 높은 양으로 하전 된 단백질 인 (PI는 ~ 10.44) Shadoo은 생리적 pH에서 집계하는 경향이있다. 그러나 Shadoo는 산성 pH 값의 완충 용액에 완전히 용해된다. 우리는 다양한 pH 값에 아밀로이드 원 섬유에 Shadoo를 중합 여기 간단하고 효율적인 프로토콜을 제시했다. 중합 된 Shadoo는 일부 신경 퇴행성 질환의 특성을 병적 인 단백질 폴딩을 연구하는 유용한 도구를 나타냅니다. 우리의 방법을 사용하여 정제 재조합 Shadoo는 구조적 전이 과정의 추가적인 구조적 및 생화학 적 특성화를 위해 사용될 수있다. 그 기본 구조에 기초하여,이 Shadoo glycosylphosphatidyli의 첨부 한 N - 결합 글리코 실화 부위 및 신호 펩티드가 예측되었다nositol (GPI) 앵커의 C- 말단 (그림 1A) 옆에. 대장균 발현 시스템은 번역 후 변형을 수행 할 수 없기 때문에, 봉입체로부터 정제 된 재조합 Shadoo 탄수화물을 박탈한다. 결과적으로, 단백질, 지질 또는 핵산과 재조합 Shadoo의 상호 작용은 천연 단백질과 비교하여 변형 될 수있다. 예를 들어, 글리코 실화 Shadoo의 중요성이 최근에 유비퀴틴 (21)에 의해 변형 된 단백질의 후 Shadoo 테아 분해를 위해 제안되었다. 프리온 질병에 GPI 앵커의 역할은 잘 알려져 있지만, 많은 연구 GPI 앵커 프리온 질병 (22, 23)의 병인에서 역할을 할 수 있음을 시사하지 않는다. 따라서, 박테리아는 Shadoo 계정에 이러한 한계를 복용 생체 외 연구에 사용할 수있는 표현.

인간의 양 및 크로이츠 펠트 - 야콥병에서 소 해면상 소에서 뇌, 스크래피를 포함 프리온 신경 퇴행성 질환은 치명적 및 불치이다. 프리온 질병은 주로 가교 β 시트로, α-나선 이루어지는 세포 프리온 단백질의 형태 적 변화에 의해 특징 1,2- 콘 포머 (conformer) 아밀로이드 농후. 크로스 - β-구조는 조밀 포함 높은 순서 결정과 같은 β-시트는 수소 결합 3,4 안정화. 프리온 아밀로이드 모집에 대한 템플릿을 제공하고 단량체 단백질 변환 부 성장 가장자리에 β-가닥에 의한 자기 복제를 할 수 있습니다. &quot;단백질 만&quot;가설에 따르면, 프리온 단백질 아밀로이드 콘 포머 (conformer)가 단독 감염원이다. 그러나, 일부 다른 생체 분자 프리온 질환에 필수적인 것으로 제안되어있다. 예를 들어, 세포막 곳 어디 conversi 것으로 생각되고켜짐 일어나며 일부 음으로 하전 된 지질은 변환 처리 5,6-을 강화하는 것으로 나타났다. 또한, 일부 단백질은 또한 프리온 병리에 관여 할 수있다. Doppel 및 Shadoo 7,8 : 특히, 프리온 단백질 가족의 다른 두 멤버가있다. Doppel는 디 황화 다리와 안정 상대적으로 견고한 구조를 가지고 있으며, 아밀로이드 원 섬유 (9)에 자기 중합 집계에 실패합니다. 반면, 프리온 단백질과 유사하게, Shadoo 아밀로이드 피 브릴 구조로 β 시트 - 풍부 구조의 자기 준을 채택 할 수있다. 그것은 Shadoo가 기본 조건 또는 음전하 막 10, 11 바인딩에 피 브릴 수있는 것으로 나타났다. 아밀로이드 섬유 형상으로의 변환은 Shadoo 병리와 연관 될 수있다. 실제로, 아밀로이드 형 구조는 질병을 야기하는 메커니즘이 제대로 이해된다. Shadoo은 소수성 도메인 (HD)와 직렬의 Arg / 대 Gly 맺는 일련의 유사한 반복 t프리온 단백질 (도 1a)의 N- 말단 부분 O. 프리온 단백질의 N 말단 부분으로서, Shadoo 매우 양전하와 기본적으로 구조화 단백질 11,12 것으로 나타나고있다. 직접적 프리온 단백질에 결합 할 수 있기 때문에 Shadoo 프리온 질환과 기능적으로 관련이있을 것 같다. 또한, 그것의 발현은 다운 프리온 병리학 13,14 동안 조절된다. 그러나 프리온 질환에 Shadoo의 역할은 아직 확립되어 있지 않습니다. 우리는 마우스 Shadoo 유전자의 코딩 서열을 운반하는 플라스미드를 개발 하였다. E. 플라스미드를 형질 전환시켰다 대장균 N- 말단 그의 6 융합 Shadoo 단백질의 생산. 이 발현 시스템은 잘 우리의 실험실에 설립되어 일반적으로 우리의 진행하는 프로젝트 6,15,16에 사용됩니다. Shadoo의 표현을위한 중요한 문제는 E.의 선택 대장균 균주. 유능한 BL21 균주는 일반적으로 재조합 프로의 표현에 사용되는 동안teins Shadoo 성공적으로 표현하고 변환 된 SoluBL21 균주에서만 정제 하였다. SoluBL21 관할 E. 대장균 발현 상위 BL21에서 검출 가능한 가용성 생성물을 수득되지 단백질의 생산을 위해 개발 BL21의 숙주 균주의 개선 돌연변이이다. SoluBL21 E.에서 Shadoo의 높은 수준의 표현 대장균 봉입체에서 단백질의 축적에 이르게. 비 - 천연 단백질은 E. 고도로 표현된다 일반적인 기능뿐만 대장균은,이 단백질은 불용성 봉입체에 축적되는 경향이있다. Shadoo 아마 여러도에 접힌 단백질에 의해 형성 고농축 동적 구조 비공유 소수성 또는 이온의 상호 작용 (또는이 둘의 조합)을 통해 집계합니다. (I) 변성 매체로부터 다른 생체 단백질의 선택적 분리, (ⅱ) 정제 된 단백질의 탈 변성 시험 관내 폴딩에 사용 : 결과적으로, 정제는 적어도 두 개의 단계를 포함기법. Shadoo의 선택적 분리는 8M 우레아 (또는 대안 6M 염산 구아니딘)를 함유하는 완충액에 달성되었다. (ⅰ) 탈 변성을 산성 pH의 용액에서 Shadoo의 중합을 수득하여 pH ≥의 용액 7 비정형 단량체 Shadoo 단백질, 또는 (ⅱ) 탈 변성을 얻었다 : 우레아 및 제거 단백질의 탈 변성은 다양한 프로토콜을 적용하여 수행 할 수있다 특성 크로스 - β 시트 모티브와 안정 아밀로이드 섬유로.

<table><tbody><tr><td>AKTA FPLC&amp;nbsp;</td><td>GE, Amersham</td><td># 1363</td><td></td></tr><tr><td>HiLoad 16/60 Superdex</td><td>GE Healthcare</td><td>17-1069-01</td><td></td></tr><tr><td>HiTrap IMAC</td><td>GE Healthcare</td><td>GE17-0920-05</td><td></td></tr><tr><td>HiPrep26/10 Desalting column</td><td>GE Healthcare</td><td>GE17-5087-01</td><td></td></tr><tr><td>SoluBL21 Competent E. coli</td><td>Genlantis</td><td>C700200</td><td></td></tr><tr><td>pET-28b+</td><td>Novogen</td><td>69865-3</td><td></td></tr><tr><td>IPTG</td><td>Sigma-Aldrich</td><td>I6758</td><td></td></tr><tr><td>LB-Broth medium</td><td>Sigma-Aldrich</td><td>L3022</td><td></td></tr><tr><td>Eppendorf Biophotometar</td><td>Eppendorf</td><td>550507804</td><td></td></tr><tr><td>Trito X-100</td><td>Life Technologies</td><td>85111</td><td></td></tr><tr><td>NiSO4</td><td>Sigma-Aldrich</td><td>656895</td><td></td></tr><tr><td>EDTA</td><td>Sigma-Aldrich</td><td>E6758</td><td></td></tr><tr><td>Tris-HCl</td><td>Sigma-Aldrich</td><td>RES3098T</td><td></td></tr><tr><td>Protease Inhibitor Cocktail Tablets</td><td>Roche</td><td>4693116001</td><td></td></tr><tr><td>NaCl</td><td>Sigma-Aldrich</td><td>746398</td><td></td></tr><tr><td>Imidazol</td><td>Sigma-Aldrich</td><td>I5513</td><td></td></tr><tr><td>Gdn-HCl</td><td>Sigma-Aldrich</td><td>G4505</td><td></td></tr><tr><td>protein size marker&amp;nbsp;</td><td>Thermo Fisher Scientific</td><td>26620</td><td></td></tr></tbody></table>

purification and refolding to amyloid fibrils of (his)6-tagged recombinant shadoo protein expressed as inclusion bodies in e. coli

대장균 발현 시스템은 재조합 진핵 단백질의 생산을위한 강력한 도구이다. 우리는 Shadoo, 프리온 가족에 속하는 단백질을 생산하기 위해 사용합니다. 봉입체 설명 된 바와 같이 (그의) 6 -tagged 재조합 Shadoo의 정제를위한 크로마토 그래피 방법을 표현했다. 봉입체는 8 M 유레아에 용해하고 이온 친 화성 크로마토 그래피를 수행하는 니켈 2+ -charged 칼럼에 결합된다. 결합 된 단백질은 이미 다졸 구배로 용출된다. Shadoo 단백질을 함유하는 분획을 고도로 정제 된 단백질을 수득하는 크기 배제 크로마토 그래피를 실시한다. 마지막 단계 정제 Shadoo에서 염, 우레아 및 이미 다졸을 제거하는 탈염된다. 재조합 Shadoo 단백질 프리온 질환에서 발생하는 단백질의 입체 장애의 생물 물리학 및 생화학 연구를위한 중요한 시약이다. 대부분의 보고서는 프리온 신경 퇴행성 질환이 자상의 증착에서 발생한 것을 증명제작은 아밀로이드 원 섬유를 주문했다. 산성 및 중성에서 아밀로이드 원 섬유로 Shadoo을 피 브릴하는 방법을 설명하는 샘플 프로토콜 / 기본 pH 값이 표시됩니다. 생산하고 신속하고 저렴한 비용으로 단백질의 대량 생산이 가능하기 때문에 Shadoo은, 프리온 질환에 작업 실험실에서 연구를 용이하게 할 수있다 피 브릴하는 방법에 대한 방법.

정제 Shadoo 단백질의 5-10 mg의 세균 배양 리터당 얻어진다. 두 단계의 정제는 고순도의 재조합 Shadoo을 구하는데 필요하다. 첫 번째 단계는 그의 - 태그 - 단백질을 유지하는 니켈 2 + -charged 컬럼 친 화성 크로마토 그래피에 의해 수행된다. 용출 분획을 SDS-PAGE를 실시하고 쿠마 브릴리언트 블루 (그림 5A)로 염색한다. Shadoo 단백질을 함유하는 분획을 모으고 또한 그 크기에 따라 분리하여 단백질을 크기 배제 크로마토 그래피 (Shadoo 분자량이 약 12​​ kDa의 경우)에 의해 정제된다. 용출에 수집 된 분획을 SDS-PAGE / 쿠마 분석 (그림 5B)에 의해 시각입니다. 또한 Shadoo은 단백질 C 말단 영역 (도 5C)로부터 76에서 1백5까지 아미노산 사이에 민감한 에피토프에 결합하는 특정 항 Shadoo 항체를 사용 SPRN 웨스턴 블롯에 의해 입증된다. Shadoo에 폴딩myloid 브릴은 THT 염색법 (도 6A)에 의해 염색과 음극 전자 현미경 (도 6B)에 의해 검증된다. THT는 아밀로이드 어셈블리에 대한 특성 크로스 - β-시트 급 구조를 결합하는 형광 염료입니다. 도 6a에서 THT 강도의 증가는 Shadoo가 amyloidal 구조로 전환하고 있음을 나타냅니다. <img alt="그림 6" src="/files/ftp_upload/53432/53432fig6.jpg" /> 그림 6. 대표 결과. 2 μm의 단량체 해당하는 농도의 (A) Shadoo 원 섬유는 실온에서 5 분간 THT (10 μm의 최종 농도)를 미리 배양 하였다. 형광 발광 강도를 435 nm의 여기 파장을 사용하여 각 샘플에 대해 기록된다. Shadoo가 제어들에 비해 아밀로이드 피 브릴을 함유하는 용액 중합에 THT 형광 강도의 현저한 증가를 참고단량체 Shadoo의 olution. 피 브릴 Shadoo의 (B) 투과 전자 현미경. <a href="https://www-jove-com.bdigitaluss.remotexs.co/files/ftp_upload/53432/53432fig6highres.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a>

Watch this Scientific Journal Video about Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli at JoVE.com

Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures.

정제 및 아밀로이드 피 브릴로 리 폴딩 (그의)<sub&gt; 6</sub&gt; -tagged 재조합 Shadoo 단백질의 봉입체로 표현<em&gt; 대장균</em

The Escherichia coli expression system is a powerful tool for the production of recombinant eukaryotic proteins. We use it to produce Shadoo, a protein ...

purification-refolding-to-amyloid-fibrils-his-6-tagged-recombinant

Universidad San Sebastian

Research

JoVE Journal

Biology

Purification and Refolding to Amyloid Fibrils of (His)6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

14.1K 조회수.  INRA. A two-step chromatographic method is described for the purification of recombinant Shadoo protein expressed as inclusion bodies in Escherichia coli, as well as a protocol to fibrillate purified Shadoo into amyloid structures. 

비디오: Purification and Refolding to Amyloid Fibrils of His6-tagged Recombinant Shadoo Protein Expressed as Inclusion Bodies in E. coli

High Precision FRET at Single-molecule Level for Biomolecule Structure Determination

A protocol on how to perform high-precision interdye distance measurements using F&#246;rster resonance energy transfer (FRET) at the single-molecule level in multiparameter fluorescence detection (MFD) mode is presented here. MFD maximizes the usage of all &#34;dimensions&#34; of fluorescence to reduce photophysical and experimental artifacts and allows for the measurement of interdye distance with an accuracy up to ~1 &#197; in rigid biomolecules. This method was used to identify three conformational states of the ligand-binding domain of the N-methyl-D-aspartate (NMDA) receptor to explain the activation of the receptor upon ligand binding. When comparing the known crystallographic structures with experimental measurements, they agreed within less than 3 &#197; for more dynamic biomolecules. Gathering a set of distance restraints that covers the entire dimensionality of the biomolecules would make it possible to provide a structural model of dynamic biomolecules.

A protocol for high-precision FRET experiments at the single molecule level is presented here. Additionally, this methodology can be used to identify three conformational states in the ligand-binding domain of the N-methyl-D-aspartate (NMDA) receptor. Determining precise distances is the first step towards building structural models based on FRET experiments.

생체 분자 구조 결정을위한 단일 분자 수준의 고정밀 FRET

A protocol on how to perform high-precision interdye distance measurements using F&#246;rster resonance energy transfer (FRET) at the single-molecule ...

연구

생화학

From Constructs to Crystals &#8211; Towards Structure Determination of &#946;-barrel Outer Membrane Proteins

Membrane proteins serve important functions in cells such as nutrient transport, motility, signaling, survival and virulence, yet constitute only ~1% percent of known structures. There are two types of membrane proteins, &#945;-helical and &#946;-barrel. While &#945;-helical membrane proteins can be found in nearly all cellular membranes, &#946;-barrel membrane proteins can only be found in the outer membranes of mitochondria, chloroplasts, and Gram-negative bacteria. One common bottleneck in structural studies of membrane proteins in general is getting enough pure sample for analysis. In hopes of assisting those interested in solving the structure of their favorite &#946;-barrel outer membrane protein (OMP), general protocols are presented for the production of target &#946;-barrel OMPs at levels useful for structure determination by either X-ray crystallography and/or NMR spectroscopy. Here, we outline construct design for both native expression and for expression into inclusion bodies, purification using an affinity tag, and crystallization using detergent screening, bicelle, and lipidic cubic phase techniques. These protocols have been tested and found to work for most OMPs from Gram-negative bacteria; however, there are some targets, particularly for mitochondria and chloroplasts that may require other methods for expression and purification. As such, the methods here should be applicable for most projects that involve OMPs from Gram-negative bacteria, yet the expression levels and amount of purified sample will vary depending on the target OMP.

&#946;-barrel outer membrane proteins (OMPs) serve many functions within the outer membranes of Gram-negative bacteria, mitochondria, and chloroplasts. Here, we hope to alleviate a known bottleneck in structural studies by presenting protocols for the production of &#946;-barrel OMPs in sufficient quantities for structure determination by X-ray crystallography or NMR spectroscopy.

β-배럴 외부 막 단백질의 구조 결정을 향해 - 구축해에서 결정에

Membrane proteins serve important functions in cells such as nutrient transport, motility, signaling, survival and virulence, yet constitute only ~1% ...

화학

Method for Efficient Refolding and Purification of Chemoreceptor Ligand Binding Domain

Identification of natural ligands of chemoreceptors and structural studies aimed at elucidation of the molecular basis of the ligand specificity can be greatly facilitated by the production of milligram amounts of pure, folded ligand binding domains. Attempts to heterologously express periplasmic ligand binding domains of bacterial chemoreceptors in Escherichia coli (E. coli) often result in their targeting into inclusion bodies. Here, a method is presented for protein recovery from inclusion bodies, its refolding and purification, using the periplasmic dCACHE ligand binding domain of Campylobacter jejuni (C. jejuni) chemoreceptor Tlp3 as an example. The approach involves expression of the protein of interest with a cleavable His6-tag, isolation and urea-mediated solubilisation of inclusion bodies, protein refolding by urea depletion, and purification by means of affinity chromatography, followed by tag removal and size-exclusion chromatography. The circular dichroism spectroscopy is used to confirm the folded state of the pure protein. It has been demonstrated that this protocol is generally useful for production of milligram amounts of dCACHE periplasmic ligand binding domains of other bacterial chemoreceptors in a soluble and crystallisable form.

A procedure is presented for the refolding of the dCACHE periplasmic ligand binding domain of Campylobacter jejuni chemoreceptor Tlp3 from inclusion bodies and the purification to yield milligram quantities of protein.

효율적인 Refolding 및 Chemoreceptor Ligand 바인딩 도메인의 정화 방법

Identification of natural ligands of chemoreceptors and structural studies aimed at elucidation of the molecular basis of the ligand specificity can be ...

Purification and Aggregation of the Amyloid Precursor Protein Intracellular Domain

Amyloid precursor protein (APP) is a type I transmembrane protein associated with the pathogenesis of Alzheimer's disease (AD). APP is characterized by a large extracellular domain and a short cytosolic domain termed the APP intracellular domain (AICD). During maturation through the secretory pathway, APP can be cleaved by proteases termed &alpha;, &beta;, and &gamma;-secretases1. Sequential proteolytic cleavage of APP with &beta; and &gamma;-secretases leads to the production of a small proteolytic peptide, termed A&beta;, which is amyloidogenic and the core constituent of senile plaques. The AICD is also liberated from the membrane after secretase processing, and through interactions with Fe65 and Tip60, can translocate to the nucleus to participate in transcription regulation of multiple target genes2,3. Protein-protein interactions involving the AICD may affect trafficking, processing, and cellular functions of holo-APP and its C-terminal fragments. We have recently shown that AICD can aggregate in vitro, and this process is inhibited by the AD-implicated molecular chaperone ubiquilin-14. Consistent with these findings, the AICD has exposed hydrophobic domains and is intrinsically disordered in vitro5,6, however it obtains stable secondary structure when bound to Fe657. We have proposed that ubiquilin-1 prevents inappropriate inter- and intramolecular interactions of AICD, preventing aggregation in vitro and in intact cells4. While most studies focus on the role of APP in the pathogenesis of AD, the role of AICD in this process is not clear. Expression of AICD has been shown to induce apoptosis8, to modulate signaling pathways9, and to regulate calcium signaling10. Over-expression of AICD and Fe65 in a transgenic mouse model induces Alzheimer's like pathology11, and recently AICD has been detected in brain lysates by western blotting when using appropriate antigen retrieval techniques12. To facilitate structural, biochemical, and biophysical studies of the AICD, we have developed a procedure to produce recombinantly large amounts of highly pure AICD protein. We further describe a method for inducing the in vitro thermal aggregation of AICD and analysis by atomic force microscopy. The methods described are useful for biochemical, biophysical, and structural characterization of the AICD and the effects of molecular chaperones on AICD aggregation.

A method for large-scale purification of the APP intracellular domain (AICD) is described. We also describe methodology to induce in vitro AICD aggregation and visualization by atomic force microscopy. The methods described are useful for biochemical/structural characterization of the AICD and the effects of molecular chaperones on its aggregation.

아밀로이드 전구체 단백질 세포 내 도메인의 정화 및 집계

Amyloid precursor protein (APP) is a type I transmembrane protein associated with the pathogenesis of Alzheimer's disease (AD). APP is characterized by a ...

의학

Synthesis of an Intein-mediated Artificial Protein Hydrogel

We present the synthesis of a highly stable protein hydrogel mediated by a split-intein-catalyzed protein trans-splicing reaction. The building blocks of this hydrogel are two protein block-copolymers each containing a subunit of a trimeric protein that serves as a crosslinker and one half of a split intein. A highly hydrophilic random coil is inserted into one of the block-copolymers for water retention. Mixing of the two protein block copolymers triggers an intein trans-splicing reaction, yielding a polypeptide unit with crosslinkers at either end that rapidly self-assembles into a hydrogel. This hydrogel is very stable under both acidic and basic conditions, at temperatures up to 50 &#176;C, and in organic solvents. The hydrogel rapidly reforms after shear-induced rupture. Incorporation of a &#34;docking station peptide&#34; into the hydrogel building block enables convenient incorporation of &#34;docking protein&#34;-tagged target proteins. The hydrogel is compatible with tissue culture growth media, supports the diffusion of 20 kDa molecules, and enables the immobilization of bioactive globular proteins. The application of the intein-mediated protein hydrogel as an organic-solvent-compatible biocatalyst was demonstrated by encapsulating the horseradish peroxidase enzyme and corroborating its activity.

We present the synthesis of a split-intein-mediated protein hydrogel. The building blocks of this hydrogel are two protein copolymers each containing a subunit of a trimeric protein that serves as a crosslinker and one half of a split intein. Mixing of the two protein copolymers triggers an intein trans-splicing reaction, yielding a polypeptide unit that self-assembles into a hydrogel. This hydrogel is highly pH- and temperature-stable, compatible with organic solvents, and easily incorporates functional globular proteins.

테인 매개 인공 단백질 히드로 겔의 합성

We present the synthesis of a highly stable protein hydrogel mediated by a split-intein-catalyzed protein trans-splicing reaction. The building blocks of ...

생체공학

Expression, Purification, Crystallization, and Enzyme Assays of Fumarylacetoacetate Hydrolase Domain-Containing Proteins

Fumarylacetoacetate hydrolase (FAH) domain-containing proteins (FAHD) are identified members of the FAH superfamily in eukaryotes. Enzymes of this superfamily generally display multi-functionality, involving mainly hydrolase and decarboxylase mechanisms. This article presents a series of consecutive methods for the expression and purification of FAHD proteins, mainly FAHD protein 1 (FAHD1) orthologues among species (human, mouse, nematodes, plants, etc.). Covered methods are protein expression in E. coli, affinity chromatography, ion exchange chromatography, preparative and analytical gel filtration, crystallization, X-ray diffraction, and photometric assays. Concentrated protein of high levels of purity (&#62;98%) may be employed for crystallization or antibody production. Proteins of similar or lower quality may be employed in enzyme assays or used as antigens in detection systems (Western-Blot, ELISA). In the discussion of this work, the identified enzymatic mechanisms of FAHD1 are outlined to describe its hydrolase and decarboxylase bi-functionality in more detail.

Expression and purification of fumarylacetoacetate hydrolase domain-containing proteins is described with examples (expression in E. coli, FPLC). Purified proteins are used for crystallization and antibody production and employed for enzyme assays. Selected photometric assays are presented to display the multi-functionality of FAHD1 as oxaloacetate decarboxylase and acylpyruvate hydrolase.

Fumarylacetotate 하이드로 아세테이트 도메인 함유 단백질의 발현, 정제, 결정화 및 효소 어세포

Fumarylacetoacetate hydrolase (FAH) domain-containing proteins (FAHD) are identified members of the FAH superfamily in eukaryotes. Enzymes of this ...

Targeting Cysteine Thiols for in Vitro Site-specific Glycosylation of Recombinant Proteins

Stromal interaction molecule-1 (STIM1) is a type-I transmembrane protein located on the endoplasmic reticulum (ER) and plasma membranes (PM). ER-resident STIM1 regulates the activity of PM Orai1 channels in a process known as store operated calcium (Ca2+) entry which is the principal Ca2+ signaling process that drives the immune response. STIM1 undergoes post-translational N-glycosylation at two luminal Asn sites within the Ca2+ sensing domain of the molecule. However, the biochemical, biophysical, and structure biological effects of N-glycosylated STIM1 were poorly understood until recently due to an inability to readily obtain high levels of homogeneous N-glycosylated protein. Here, we describe the implementation of an in vitro chemical approach which attaches glucose moieties to specific protein sites applicable to understanding the underlying effects of N-glycosylation on protein structure and mechanism. Using solution nuclear magnetic resonance spectroscopy we assess both efficiency of the modification as well as the structural consequences of the glucose attachment with a single sample. This approach can readily be adapted to study the myriad glycosylated proteins found in nature.

Targeting Cysteine Thiols for in Vitro Site-specific Glycosylation of Recombinant Proteins

Biochemical and structural analyses of glycosylated proteins require relatively large amounts of homogeneous samples. Here, we present an efficient chemical method for site-specific glycosylation of recombinant proteins purified from bacteria by targeting reactive Cys thiols.

재조합 형 단백질의 생체 외에서 사이트별 Glycosylation에 대 한 대상 시스테인 Thiols

Stromal interaction molecule-1 (STIM1) is a type-I transmembrane protein located on the endoplasmic reticulum (ER) and plasma membranes (PM). ER-resident ...

면역학 및 감염병학

Purification of Hsp104, a Protein Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key selective advantages. First, renaturation of disordered aggregates by Hsp104 empowers yeast survival after various protein-misfolding stresses, including heat shock3,5,11,12. Second, remodeling of cross-beta amyloid fibrils by Hsp104 enables yeast to exploit myriad prions (infectious amyloids) as a reservoir of beneficial and heritable phenotypic variation13-22. Remarkably, Hsp104 directly remodels preamyloid oligomers and amyloid fibrils, including those comprised of the yeast prion proteins Sup35 and Ure223-30. This amyloid-remodeling functionality is a specialized facet of yeast Hsp104. The E. coli orthologue, ClpB, fails to remodel preamyloid oligomers or amyloid fibrils26,31,32.
Hsp104 orthologues are found in all kingdoms of life except, perplexingly, animals. Indeed, whether animal cells possess any enzymatic system that couples protein disaggregation to renaturation (rather than degradation) remains unknown33-35. Thus, we and others have proposed that Hsp104 might be developed as a therapeutic agent for various neurodegenerative diseases connected with the misfolding of specific proteins into toxic preamyloid oligomers and amyloid fibrils4,7,23,36-38. There are no treatments that directly target the aggregated species associated with these diseases. Yet, Hsp104 dissolves toxic oligomers and amyloid fibrils composed of alpha-synuclein, which are connected with Parkinson's Disease23 as well as amyloid forms of PrP39. Importantly, Hsp104 reduces protein aggregation and ameliorates neurodegeneration in rodent models of Parkinson's Disease23 and Huntington's disease38. Ideally, to optimize therapy and minimize side effects, Hsp104 would be engineered and potentiated to selectively remodel specific aggregates central to the disease in question4,7. However, the limited structural and mechanistic understanding of how Hsp104 disaggregates such a diverse repertoire of aggregated structures and unrelated proteins frustrates these endeavors30,40-42.
To understand the structure and mechanism of Hsp104, it is essential to study the pure protein and reconstitute its disaggregase activity with minimal components. Hsp104 is a 102kDa protein with a pI of ~5.3, which hexamerizes in the presence of ADP or ATP, or at high protein concentrations in the absence of nucleotide43-46. Here, we describe an optimized protocol for the purification of highly active, stable Hsp104 from E. coli. The use of E. coli allows simplified large-scale production and our method can be performed quickly and reliably for numerous Hsp104 variants. Our protocol increases Hsp104 purity and simplifies His6-tag removal compared to a previous purification method from E. coli47. Moreover, our protocol is more facile and convenient than two more recent protocols26,48.

Here, we describe a protocol for the purification of highly active Hsp104, a hexameric AAA+ protein from yeast, which couples ATP hydrolysis to protein disaggregation. This scheme exploits a His6-tagged construct for affinity purification from E. coli followed by anion-exchange chromatography, His6-tag removal with TEV protease, and size-exclusion chromatography.

Hsp104의 정화, 단백질 Disaggregase

Hsp104 is a hexameric AAA+ protein1 from yeast, which couples ATP hydrolysis to protein disaggregation2-10 (Fig. 1). This activity imparts two key ...

생물학

Production of E. coli-expressed Self-Assembling Protein Nanoparticles for Vaccines Requiring Trimeric Epitope Presentation

Self-assembling protein nanoparticles (SAPNs) function as repetitive antigen displays and can be used to develop a wide range of vaccines for different infectious diseases. In this article we demonstrate a method to produce a SAPN core containing a six-helix bundle (SHB) assembly that is capable of presenting antigens in a trimeric conformation. We describe the expression of the SHB-SAPN in an E. coli system, as well as the necessary protein purification steps. We included an isopropanol wash step to reduce the residual bacterial lipopolysaccharide. As an indication of the protein identity and purity, the protein reacted with known monoclonal antibodies in Western blot analyses. After refolding, the size of the particles fell in the expected range (20 to 100 nm), which was confirmed by dynamic light scattering, nanoparticle tracking analysis, and transmission electron microscopy. The methodology described here is optimized for the SHB-SAPN, however, with only slight modifications it can be applied to other SAPN constructs. This method is also easily transferable to large scale production for GMP manufacturing for human vaccines.

Production of E. coli-expressed Self-Assembling Protein Nanoparticles for Vaccines Requiring Trimeric Epitope Presentation

A detailed method is provided here describing the purification, refolding, and characterization of self-assembling protein nanoparticles (SAPNs) for use in vaccine development.

삼중 에피토프 프리젠 테이션을 필요로하는 백신을위한 대장균- 발현 자가 조립 단백질 나노 입자의 생산

Self-assembling protein nanoparticles (SAPNs) function as repetitive antigen displays and can be used to develop a wide range of vaccines for different ...

Rapid Generation of Amyloid from Native Proteins In vitro

Proteins carry out crucial tasks in organisms by exerting functions elicited from their specific three dimensional folds. Although the native structures of polypeptides fulfill many purposes, it is now recognized that most proteins can adopt an alternative assembly of beta-sheet rich amyloid. Insoluble amyloid fibrils are initially associated with multiple human ailments, but they are increasingly shown as functional players participating in various important cellular processes. In addition, amyloid deposited in patient tissues contains nonproteinaceous components, such as nucleic acids and glycosaminoglycans (GAGs). These cofactors can facilitate the formation of amyloid, resulting in the generation of different types of insoluble precipitates. By taking advantage of our understanding how proteins misfold via an intermediate stage of soluble amyloid precursor, we have devised a method to convert native proteins to amyloid fibrils in vitro. This approach allows one to prepare amyloid in large quantities, examine the properties of amyloid generated from specific proteins, and evaluate the structural changes accompanying the conversion.

Rapid Generation of Amyloid from Native Proteins In vitro

Proteins can either adopt a native structure or misfold into insoluble amyloid. Conditions that favor the misfolding pathway lead to the formation of different types of amyloid fibrils. The methods described here allow rapid conversion of native proteins into amyloid in vitro.

천연 단백질에서 아밀로이드의 빠른 생성<em&gt; 체외</em

Proteins carry out crucial tasks in organisms by exerting functions elicited from their specific three dimensional folds. Although the native structures ...

정제 및 아밀로이드 피 브릴로 리 폴딩 (그의)

요약

더 많은 비디오 탐색

이 비디오의 챕터